PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G25830.1
Common NameF18A17.80, GATA12
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family GATA
Protein Properties Length: 331aa    MW: 36489.2 Da    PI: 5.2309
Description GATA transcription factor 12
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G25830.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.39.1e-18221255135
         GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                  C +C t kTp+WR gp g+ktLCnaCG++y++ +l
  AT5G25830.1 221 CLHCATDKTPQWRTGPMGPKTLCNACGVRYKSGRL 255
                  99*****************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.0E-791309IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.635215251IPR000679Zinc finger, GATA-type
SMARTSM004018.7E-18215265IPR000679Zinc finger, GATA-type
SuperFamilySSF577168.08E-16217279No hitNo description
Gene3DG3DSA:3.30.50.101.9E-14217252IPR013088Zinc finger, NHR/GATA-type
CDDcd002026.54E-15220267No hitNo description
PfamPF003201.2E-15221255IPR000679Zinc finger, GATA-type
PROSITE patternPS003440221246IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009416Biological Processresponse to light stimulus
GO:0030154Biological Processcell differentiation
GO:0045944Biological Processpositive regulation of transcription from RNA polymerase II promoter
GO:0005634Cellular Componentnucleus
GO:0005667Cellular Componenttranscription factor complex
GO:0000977Molecular FunctionRNA polymerase II regulatory region sequence-specific DNA binding
GO:0001085Molecular FunctionRNA polymerase II transcription factor binding
GO:0001228Molecular Functiontranscriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding
GO:0003682Molecular Functionchromatin binding
GO:0008270Molecular Functionzinc ion binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000013anatomycauline leaf
PO:0000230anatomyinflorescence meristem
PO:0000293anatomyguard cell
PO:0009005anatomyroot
PO:0009009anatomyplant embryo
PO:0009010anatomyseed
PO:0009030anatomycarpel
PO:0009031anatomysepal
PO:0009032anatomypetal
PO:0009046anatomyflower
PO:0009052anatomyflower pedicel
PO:0020100anatomyhypocotyl
PO:0025022anatomycollective leaf structure
PO:0001078developmental stageplant embryo cotyledonary stage
PO:0001081developmental stagemature plant embryo stage
PO:0001185developmental stageplant embryo globular stage
PO:0004507developmental stageplant embryo bilateral stage
PO:0007611developmental stagepetal differentiation and expansion stage
PO:0007616developmental stageflowering stage
Sequence ? help Back to Top
Protein Sequence    Length: 331 aa     Download sequence    Send to blast
MEDEAHEFFH TSDFAVDDLL VDFSNDDDEE NDVVADSTTT TTITDSSNFS AADLPSFHGD  60
VQDGTSFSGD LCIPSDDLAD ELEWLSNIVD ESLSPEDVHK LELISGFKSR PDPKSDTGSP  120
ENPNSSSPIF TTDVSVPAKA RSKRSRAAAC NWASRGLLKE TFYDSPFTGE TILSSQQHLS  180
PPTSPPLLMA PLGKKQAVDG GHRRKKDVSS PESGGAEERR CLHCATDKTP QWRTGPMGPK  240
TLCNACGVRY KSGRLVPEYR PAASPTFVLA KHSNSHRKVM ELRRQKEMSR AHHEFIHHHH  300
GTDTAMIFDV SSDGDDYLIH HNVGPDFRQL I
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO1865257440.0
Genevisible246913_at0.0
Expression AtlasAT5G25830-
AtGenExpressAT5G25830-
ATTED-IIAT5G25830-
Functional Description ? help Back to Top
Source Description
TAIREncodes a member of the GATA factor family of zinc finger transcription factors.
UniProtTranscriptional activator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. May be involved in the regulation of some light-responsive genes (By similarity). {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00530DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G25830.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G25830
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4937580.0AB493758.1 Arabidopsis thaliana At5g25830 mRNA for hypothetical protein, partial cds, clone: RAAt5g25830.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_197955.10.0GATA transcription factor 12
SwissprotP697810.0GAT12_ARATH; GATA transcription factor 12
TrEMBLC0SVQ50.0C0SVQ5_ARATH; Putative uncharacterized protein At5g25830 (Fragment)
STRINGAT5G25830.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66252644
Representative plantOGRP6817287
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Jeong MJ,Jeong MJ,Shih MC
    Interaction of a GATA factor with cis-acting elements involved in light regulation of nuclear genes encoding chloroplast glyceraldehyde-3-phosphate dehydrogenase in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2003. 300(2): p. 555-62
    [PMID:12504119]
  3. Reyes JC,Muro-Pastor MI,Florencio FJ
    The GATA family of transcription factors in Arabidopsis and rice.
    Plant Physiol., 2004. 134(4): p. 1718-32
    [PMID:15084732]
  4. Wang XJ,Cao XL,Hong Y
    Isolation and characterization of flower-specific transcripts in Acacia mangium.
    Tree Physiol., 2005. 25(2): p. 167-78
    [PMID:15574398]
  5. Bi YM, et al.
    Genetic analysis of Arabidopsis GATA transcription factor gene family reveals a nitrate-inducible member important for chlorophyll synthesis and glucose sensitivity.
    Plant J., 2005. 44(4): p. 680-92
    [PMID:16262716]
  6. Cao D,Cheng H,Wu W,Soo HM,Peng J
    Gibberellin mobilizes distinct DELLA-dependent transcriptomes to regulate seed germination and floral development in Arabidopsis.
    Plant Physiol., 2006. 142(2): p. 509-25
    [PMID:16920880]
  7. Manfield IW,Devlin PF,Jen CH,Westhead DR,Gilmartin PM
    Conservation, convergence, and divergence of light-responsive, circadian-regulated, and tissue-specific expression patterns during evolution of the Arabidopsis GATA gene family.
    Plant Physiol., 2007. 143(2): p. 941-58
    [PMID:17208962]